PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10010391m
Common NameCICLE_v10010391mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NF-YB
Protein Properties Length: 240aa    MW: 26190.3 Da    PI: 6.6003
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10010391mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB162.75.2e-5162158197
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqd+++Pianv+rim+++lP +akis+daketvqecvse+isf+t+ea+++c+re+rkti+++d++wa+++lGf++yvepl+++l+++r+ e
  Ciclev10010391m  62 VREQDQYMPIANVIRIMRRILPPHAKISDDAKETVQECVSEYISFITGEANERCHREQRKTITAEDVVWAMGKLGFDNYVEPLSIFLNRFRDSE 155
                      69*******************************************************************************************9 PP

            NF-YB  95 gek 97 
                       e+
  Ciclev10010391m 156 HER 158
                      987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.3E-4860165IPR009072Histone-fold
SuperFamilySSF471133.26E-3565163IPR009072Histone-fold
PfamPF008081.2E-2468132IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-1596114No hitNo description
PROSITE patternPS00685099115IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-15115133No hitNo description
PRINTSPR006151.1E-15134152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MVSHLVSAST THPRRDSAAI AAAIHANVDN NSSSSYNNVP NEQQQQLPLQ SLLPPAGAPC  60
VVREQDQYMP IANVIRIMRR ILPPHAKISD DAKETVQECV SEYISFITGE ANERCHREQR  120
KTITAEDVVW AMGKLGFDNY VEPLSIFLNR FRDSEHERTA AQHKEPIPMP RRGPSVDYGL  180
FGLPPGPFGP VFNMGPQQGV FDPSIGGFLR EGSGSGSGSS SQATGHNHLP GFDPFAQFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-4063153393NF-YB
4awl_B3e-4063153494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4063153494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006452592.11e-179hypothetical protein CICLE_v10010391mg
SwissprotQ9SFD82e-64NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLV4UI941e-179V4UI94_9R
STRINGVIT_00s0956g00020.t011e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80422640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.12e-61NF-YB family protein